PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009796162.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 173aa    MW: 19269.8 Da    PI: 10.2903
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009796162.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.89.1e-161258248
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                    +i  ++ r vtfskRr+g++KKA EL  +++ +va ++fs+tg+ y+
  XP_009796162.1 12 KITKETSRMVTFSKRRKGLFKKAGELESMTGSRVAAVVFSPTGRPYT 58
                    688999*************************************9776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-20362IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.521363IPR002100Transcription factor, MADS-box
CDDcd001203.39E-22458No hitNo description
SuperFamilySSF554559.81E-20487IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-14525IPR002100Transcription factor, MADS-box
PfamPF003196.4E-211258IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-142540IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-144061IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MGTGKKKIQI EKITKETSRM VTFSKRRKGL FKKAGELESM TGSRVAAVVF SPTGRPYTCG  60
NVSYAIERHF SSFSEPSSSG LNSHHSNSDD VSASSSGSRS SPSPRNSLRD WLEDIDVEEC  120
QNLNQLLMLK EQLEGTREKL VSKDSECFQA LFMRGRLHKK SGLKLNFNKS NSV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009796162.11e-125PREDICTED: MADS-box transcription factor 23-like
TrEMBLK4B0J43e-64K4B0J4_SOLLC; Uncharacterized protein
STRINGSolyc01g098070.1.17e-64(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23371757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.11e-11AGAMOUS-like 29